SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46614_T100
Price: $0.00
SKU
ARP46614_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LMAN1 Antibody - middle region (ARP46614_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-LMAN1 (ARP46614_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LMAN1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 90%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR
Concentration1.0 mg/ml
Blocking PeptideFor anti-LMAN1 (ARP46614_T100) antibody is Catalog # AAP46614 (Previous Catalog # AAPS19802)
ReferenceNeve,E.P., (2005) J. Mol. Biol. 354 (3), 556-568
Gene SymbolLMAN1
Gene Full NameLectin, mannose-binding, 1
Alias SymbolsMR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53
NCBI Gene Id3998
Protein NameProtein ERGIC-53
Description of TargetLMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.The protein encoded by this gene is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.
Uniprot IDP49257
Protein Accession #NP_005561
Nucleotide Accession #NM_005570
Protein Size (# AA)510
Molecular Weight54kDa
Protein InteractionsUBC; NEDD8; YIPF3; env; PIGS; TMED2; YBX1; HSP90AA1; HNRNPU; APP; UBXN6; RAB3GAP2; RAB3GAP1; COPE; TUBB4B; TUBB3; COPB2; VCP; DNAJC7; P4HB; HSPA8; HSPA1A; COPB1; COPA; BCAP29; BCAP31; HLA-A; CANX; ELAVL1; MCFD2; F8;
  1. What is the species homology for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "LMAN1 Antibody - middle region (ARP46614_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LMAN1 Antibody - middle region (ARP46614_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    This target may also be called "MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53" in publications.

  5. What is the shipping cost for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LMAN1 Antibody - middle region (ARP46614_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LMAN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LMAN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LMAN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LMAN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LMAN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LMAN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LMAN1 Antibody - middle region (ARP46614_T100)
Your Rating
We found other products you might like!