Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP50332_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP50332_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-LIN28B (ARP50332_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human LN28B
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: GCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKK
Concentration0.5 mg/ml
Blocking PeptideFor anti-LIN28B (ARP50332_P050-FITC) antibody is Catalog # AAP50332
Gene SymbolLIN28B
Gene Full Namelin-28 homolog B
Alias SymbolsCSDD2
NCBI Gene Id389421
Protein Nameprotein lin-28 homolog B
Description of TargetThe protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumors and cancer cell lines. It is negatively regulated by microRNAs that target sites in the 3' UTR, and overexpression of this gene in primary tumors is linked to the repression of let-7 family of microRNAs and derepression of let-7 targets, which facilitates cellular transformation.
Uniprot IDQ6ZN17
Protein Accession #NP_001004317
Protein Size (# AA)250
Molecular Weight27kDa
Protein InteractionsLARP4; ZCCHC3; NIFK; NHP2; NOP10; PHAX; LARP7; TRUB2; PTCD1; RBM34; NCBP2; RALY; KRR1; EIF4A3; SNRPG; SNRPF; SNRPB2; SNRPA; PURB; PURA; NCBP1; FBL; ELAVL2; TRIM71; UBC; COPS5; USP36;
  1. What is the species homology for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    This target may also be called "CSDD2" in publications.

  5. What is the shipping cost for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LIN28B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LIN28B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LIN28B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LIN28B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LIN28B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LIN28B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LIN28B Antibody - C-terminal region : FITC (ARP50332_P050-FITC)
Your Rating
We found other products you might like!