LIMK1 Antibody (Phospho-Thr508) (OAAF07740)

Catalog No: OAAF07740 (Formerly GWB-ASB727)

Size:100 ug

Western blot analysis of lysates from COLO205 cells, using LIMK1 (Phospho-Thr508) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using LIMK1 (Phospho-Thr508) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:T508 Mouse:T508 Rat:T508
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human LIMK1 around the phosphorylation site of Thr508.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: NKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEM
• Concentration: 1mg/ml
• Specificity: LIMK1 (Phospho-Thr508) Antibody detects endogenous levels of LIMK1 only when phosphorylated at Thr508.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:10000

Target Info

• Gene Symbol: LIMK1
• Gene Full Name: LIM domain kinase 1
• Alias Symbols: LIM domain kinase 1;LIM motif-containing protein kinase;LIMK;LIMK-1.
• NCBI Gene Id: 3984
• Protein Name: LIM domain kinase 1
• Description of Target: Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).
• Uniprot ID: P53667
• Molecular Weight: 72 kDa