LILRA5 Recombinant Protein (Human) (OPCA03651)

Catalog No: OPCA03651

LILRA5 Recombinant Protein (Human) (OPCA03651) in SDS-PAGE showing the molecular weight of approximately 29.07 kDaa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Additional Information: Relevance: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
• Protein Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 42-268 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Crystal structure of the human monocyte-activating receptor, 'Group 2' leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11).Shiroishi M., Kajikawa M., Kuroki K., Ose T., Kohda D., Maenaka K.J. Biol. Chem. 281:19536-19544(2006)
• Gene Symbol: LILRA5
• Gene Full Name: leukocyte immunoglobulin like receptor A5
• Alias Symbols: CD85;CD85 antigen-like family member F;CD85F;ILT11;ILT-11;Immunoglobulin-like transcript 11;immunoglobulin-like transcript 11 protein;leucocyte Ig-like receptor A5;leukocyte Ig-like receptor 9;leukocyte immunoglobulin-like receptor 9;leukocyte immunoglobulin-like receptor subfamily A member 5;leukocyte immunoglobulin-like receptor subfamily A member 5 soluble;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7;LILRB7;LIR9;LIR-9.
• NCBI Gene Id: 353514
• Protein Name: Leukocyte immunoglobulin-like receptor subfamily A member 5
• Description of Target: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
• Uniprot ID: A6NI73
• Protein Accession #: NP_067073.1
  
• Nucleotide Accession #: NM_021250.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 29.2 kDa