LIF Protein (OPPA02030)

Catalog No: OPPA02030 (Formerly GWB-BSP058)

Size:2ug

Product Info

• Product Format: Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
  Biological Activity: Activity of murine LIF was determined by its ability to induce differentiation of murine M1myeloid leukemic cells. Min. detectable conc. of murine LIF in this specific bioassay was found to be 0.5 ng/mL. The specific activity is 100MIU/mg, where 50U is defined as the amount of murine LIF required to induce differentiation in 50% of the M1 colonies per ml of agar culture.
  Patent: The sale and/or commercial use of Recombinant Mouse LIF is prohibited in the United States of America (U.S.A).
  Product Introduction: Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
  Product Description: Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.
• Reconstitution and Storage: Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
• Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Target Info

• Gene Symbol: mLIF
• Alias Symbols: CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA, LIF Mouse, Leukemia Inhibitory Factor Mouse Recombinant
• NCBI Gene Id: 16878
• Protein Name: Leukemia inhibitory factor
• Description of Target: Recombinant Mouse Leukemia Inhibitory Factor
• Uniprot ID: P09056
• Protein Accession #: NP_032527.1