Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP54690_P050
Price: $0.00
SKU
ARP54690_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LIF (ARP54690_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LIF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-LIF (ARP54690_P050) antibody is Catalog # AAP54690 (Previous Catalog # AAPP31481)
ReferenceRobertson,M.W., (2008) Cancer Invest. 26 (3), 222-229
Gene SymbolLIF
Gene Full NameLeukemia inhibitory factor
Alias SymbolsCDF, DIA, HILDA, MLPLI
NCBI Gene Id3976
Protein NameLeukemia inhibitory factor
Description of TargetLIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.Leukaemia inhibitory factor is a cytokine that induces macrophage differentiation. Neurotransmitters and neuropeptides, well known for their role in the communication between neurons, are also capable of activating monocytes and macrophages and inducing chemotaxis in immune cells. LIF signals through different receptors and transcription factors. LIF in conjunction with BMP2 acts in synergy on primary fetal neural progenitor cells to induce astrocytes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP15018
Protein Accession #NP_002300
Nucleotide Accession #NM_002309
Protein Size (# AA)202
Molecular Weight22kDa
Protein InteractionsIL6ST; LIFR;
  1. What is the species homology for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "LIF Antibody - N-terminal region (ARP54690_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LIF Antibody - N-terminal region (ARP54690_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    This target may also be called "CDF, DIA, HILDA, MLPLI" in publications.

  5. What is the shipping cost for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LIF Antibody - N-terminal region (ARP54690_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LIF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LIF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LIF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LIF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LIF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LIF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LIF Antibody - N-terminal region (ARP54690_P050)
Your Rating
We found other products you might like!