Search Antibody, Protein, and ELISA Kit Solutions

LHX3 Antibody - middle region (ARP33644_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33644_P050-FITC Conjugated

ARP33644_P050-HRP Conjugated

ARP33644_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LHX3
Official Gene Full Name:
LIM homeobox 3
NCBI Gene Id:
8022
Protein Name:
LIM/homeobox protein Lhx3
Swissprot Id:
Q9UBR4-2
Protein Accession #:
NP_055379
Nucleotide Accession #:
NM_014564
Alias Symbols:
DKFZp762A2013, M2-LHX3, LIM3, CPHD3
Replacement Item:
This antibody may replace item sc-13261 from Santa Cruz Biotechnology.
Description of Target:
LHX3 encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
402
Molecular Weight:
44kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LHX3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LHX3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human LHX3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-LHX3 (ARP33644_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ISL2; IFT172; LDB1; CITED2; ISL1; RLIM; LMX1A; LHX1;
Blocking Peptide:
For anti-LHX3 (ARP33644_P050) antibody is Catalog # AAP33644 (Previous Catalog # AAPP04706)
Datasheets/Manuals:
Printable datasheet for anti-LHX3 (ARP33644_P050) antibody
Target Reference:
Pfaeffle,R.W., (2007) J. Clin. Endocrinol. Metab. 92 (5), 1909-1919

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...