Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LHX2 Antibody : Biotin (ARP31207_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock

Conjugation Options

ARP31207_P050 Unconjugated

ARP31207_P050-FITC Conjugated

ARP31207_P050-HRP Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LHX2
NCBI Gene Id:
9355
Official Gene Full Name:
LIM homeobox 2
Protein Name:
LIM/homeobox protein Lhx2
Swissprot Id:
P50458
Protein Accession #:
NP_004780
Nucleotide Accession #:
NM_004789
Alias Symbols:
LH2, hLhx2,
Description of Target:
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.
Protein Size (# AA):
406
Molecular Weight:
44 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LHX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LHX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence DLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYF
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data:
Anti-LHX2 (ARP31207_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
LDB1; CITED2; RLIM; MSX1; PAX6;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-LHX2 (ARP31207_P050-Biotin) antibody
Conjugation:
Biotin

Tell us what you think about this item!

Write A Review
    Please, wait...