LHCGR Recombinant Protein (Rat) (OPCA03657)

Catalog No: OPCA03657

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Additional Information: Relevance: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
• Protein Sequence: RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 27-362 aa
• Tag: C-terminal Flag-tagged

Target Info

• Reference: Lutropin-choriogonadotropin receptor: an unusual member of the G protein-coupled receptor family.McFarland K.C., Sprengel R., Phillips H.S., Koehler M., Rosemblit N., Nikolics K., Segaloff D.L., Seeburg P.H.Science 245:494-499(1989)
• Gene Symbol: Lhcgr
• Gene Full Name: luteinizing hormone/choriogonadotropin receptor
• Alias Symbols: LH receptor;LH/CG receptor;LH/CG-R;Lhr;LSHR;LSH-R;luteinizing hormone receptor;luteinizing hormone/chorionic gonadotropin receptor;lutropin-choriogonadotropic hormone receptor.
• NCBI Gene Id: 25477
• Protein Name: Lutropin-choriogonadotropic hormone receptor
• Description of Target: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
• Uniprot ID: P16235
• Protein Accession #: NP_037110.1
  
• Nucleotide Accession #: NM_012978.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 47.8 kDa