Search Antibody, Protein, and ELISA Kit Solutions

LGALS3 Antibody - N-terminal region : FITC (ARP72534_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72534_P050 Unconjugated

ARP72534_P050-HRP Conjugated

ARP72534_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
galectin 3
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-155994 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LGALS3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LGALS3.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LGALS3
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: FSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LGALS3 (ARP72534_P050-FITC) antibody is Catalog # AAP72534
Printable datasheet for anti-LGALS3 (ARP72534_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...