$0.00
In Stock
SKU
OPCA173351
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

LG14H18ORF32 Recombinant Protein (Northern pike) (OPCA173351)

Catalog#: OPCA173351
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Northern pike
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MVCIPCIVIPVLLWVYKRFLEPIIYPFIGPIISRFWPTNIAVQENGTGDVKASEKSNGACKTKADVVVANGPSANGPATPISDKKID
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA173351
Gene Symbol LG14H18ORF32
Alias Symbols CR032, clg14h18orf32
NCBI Gene Id 105023529
Protein Name UPF0729 protein C18orf32 homolog
Swissprot Id C1BY38
Protein Size (# AA) 87
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LG14H18ORF32.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LG14H18ORF32.
Write Your Own Review
You're reviewing:LG14H18ORF32 Recombinant Protein (Northern pike) (OPCA173351)
Your Rating