Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52722_P050 Unconjugated

ARP52722_P050-FITC Conjugated

ARP52722_P050-Biotin Conjugated

LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)

Catalog#: ARP52722_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-146713 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LETM2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-LETM2 (ARP52722_P050)
Peptide Sequence Synthetic peptide located within the following region: KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
Concentration 0.5 mg/ml
Blocking Peptide For anti-LETM2 (ARP52722_P050-HRP) antibody is Catalog # AAP52722 (Previous Catalog # AAPP33604)
Datasheets/Manuals Printable datasheet for anti-LETM2 (ARP52722_P050-HRP) antibody
Target Reference Stec,I., Genomics 76 (1-3), 5-8 (2001)

Dutt, A. et al. Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer. PLoS One 6, e20351 (2011). WB, Human 21666749

Gene Symbol LETM2
Official Gene Full Name Leucine zipper-EF-hand containing transmembrane protein 2
Alias Symbols FLJ25409
NCBI Gene Id 137994
Protein Name LETM1 domain-containing protein LETM2, mitochondrial
Description of Target LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
Swissprot Id Q2VYF4-3
Protein Accession # NP_653253
Nucleotide Accession # NM_144652
Protein Size (# AA) 396
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LETM2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LETM2.
Protein Interactions APP;
  1. What is the species homology for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    This target may also be called "FLJ25409" in publications.

  5. What is the shipping cost for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LETM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LETM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LETM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LETM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LETM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LETM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)
Your Rating
We found other products you might like!