Search Antibody, Protein, and ELISA Kit Solutions

LETM2 Antibody - N-terminal region : HRP (ARP52722_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52722_P050 Unconjugated

ARP52722_P050-FITC Conjugated

ARP52722_P050-Biotin Conjugated

Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
LETM2
Official Gene Full Name:
Leucine zipper-EF-hand containing transmembrane protein 2
NCBI Gene Id:
137994
Protein Name:
LETM1 domain-containing protein LETM2, mitochondrial
Swissprot Id:
Q2VYF4-3
Protein Accession #:
NP_653253
Nucleotide Accession #:
NM_144652
Alias Symbols:
FLJ25409
Replacement Item:
This antibody may replace item sc-146713 from Santa Cruz Biotechnology.
Description of Target:
LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
Protein Size (# AA):
396
Molecular Weight:
45kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LETM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LETM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LETM2
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-LETM2 (ARP52722_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
Concentration:
0.5 mg/ml
Protein Interactions:
APP;
Blocking Peptide:
For anti-LETM2 (ARP52722_P050-HRP) antibody is Catalog # AAP52722 (Previous Catalog # AAPP33604)
Datasheets/Manuals:
Printable datasheet for anti-LETM2 (ARP52722_P050-HRP) antibody
Target Reference:
Stec,I., Genomics 76 (1-3), 5-8 (2001)
Publications:

Dutt, A. et al. Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer. PLoS One 6, e20351 (2011). WB, Human 21666749

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...