Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP52722_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52722_P050-FITC Conjugated

ARP52722_P050-HRP Conjugated

ARP52722_P050-Biotin Conjugated

LETM2 Antibody - N-terminal region (ARP52722_P050)

Catalog#: ARP52722_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-146713 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LETM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-LETM2 (ARP52722_P050)
Peptide SequenceSynthetic peptide located within the following region: KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LETM2 (ARP52722_P050) antibody is Catalog # AAP52722 (Previous Catalog # AAPP33604)
Datasheets/ManualsPrintable datasheet for anti-LETM2 (ARP52722_P050) antibody
Target ReferenceStec,I., Genomics 76 (1-3), 5-8 (2001)
Publications

Dutt, A. et al. Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer. PLoS One 6, e20351 (2011). WB, Human 21666749

Gene SymbolLETM2
Official Gene Full NameLeucine zipper-EF-hand containing transmembrane protein 2
Alias SymbolsFLJ25409
NCBI Gene Id137994
Protein NameLETM1 domain-containing protein LETM2, mitochondrial
Description of TargetLETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
Swissprot IdQ2VYF4-3
Protein Accession #NP_653253
Nucleotide Accession #NM_144652
Protein Size (# AA)396
Molecular Weight45kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LETM2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LETM2.
Protein InteractionsAPP;
Write Your Own Review
You're reviewing:LETM2 Antibody - N-terminal region (ARP52722_P050)
Your Rating
Aviva Pathways
Aviva HIS tag Deal
Aviva Live Chat
Aviva Travel Grant