Search Antibody, Protein, and ELISA Kit Solutions

LETM2 Antibody - N-terminal region (ARP52722_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52722_P050-FITC Conjugated

ARP52722_P050-HRP Conjugated

ARP52722_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Leucine zipper-EF-hand containing transmembrane protein 2
NCBI Gene Id:
Protein Name:
LETM1 domain-containing protein LETM2, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-146713 from Santa Cruz Biotechnology.
Description of Target:
LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LETM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LETM2.
The immunogen is a synthetic peptide directed towards the N terminal region of human LETM2
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-LETM2 (ARP52722_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LETM2 (ARP52722_P050) antibody is Catalog # AAP52722 (Previous Catalog # AAPP33604)
Printable datasheet for anti-LETM2 (ARP52722_P050) antibody
Target Reference:
Stec,I., Genomics 76 (1-3), 5-8 (2001)

Dutt, A. et al. Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer. PLoS One 6, e20351 (2011). WB, Human 21666749

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...