Catalog No: ARP52722_P050
Price: $0.00
SKU
ARP52722_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LETM2 (ARP52722_P050) antibody
Product Info
ReferenceStec,I., Genomics 76 (1-3), 5-8 (2001)
Publications

Dutt, A. et al. Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer. PLoS One 6, e20351 (2011). 21666749

Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LETM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
Concentration0.5 mg/ml
Blocking PeptideFor anti-LETM2 (ARP52722_P050) antibody is Catalog # AAP52722 (Previous Catalog # AAPP33604)
Gene SymbolLETM2
Gene Full NameLeucine zipper-EF-hand containing transmembrane protein 2
Alias SymbolsSLC55A2
NCBI Gene Id137994
Protein NameLETM1 domain-containing protein LETM2, mitochondrial
Description of TargetLETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
Uniprot IDQ2VYF4-3
Protein Accession #NP_653253
Nucleotide Accession #NM_144652
Protein Size (# AA)396
Molecular Weight45kDa
Protein InteractionsAPP;
  1. What is the species homology for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LETM2 Antibody - N-terminal region (ARP52722_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    This target may also be called "SLC55A2" in publications.

  5. What is the shipping cost for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LETM2 Antibody - N-terminal region (ARP52722_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LETM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LETM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LETM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LETM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LETM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LETM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LETM2 Antibody - N-terminal region (ARP52722_P050)
Your Rating