- Gene Symbol:
- LEP
- NCBI Gene Id:
- 3952
- Official Gene Full Name:
- leptin
- Protein Name:
- leptin
- Swissprot Id:
- P41159
- Protein Accession #:
- NP_000221
- Nucleotide Accession #:
- NM_000230
- Alias Symbols:
- OB, OBS, LEPD
- Replacement Item:
- This antibody may replace item sc-28344 from Santa Cruz Biotechnology.
- Description of Target:
- This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
- Protein Size (# AA):
- 167
- Molecular Weight:
- 19kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express LEP.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express LEP.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human LEP
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 86%; Goat: 91%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 91%
- Complete computational species homology data:
- Anti-LEP (ARP41697_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3;
- Blocking Peptide:
- For anti-LEP (ARP41697_P050) antibody is Catalog # AAP41697 (Previous Catalog # AAPP24340)
- Datasheets/Manuals:
- Printable datasheet for anti-LEP (ARP41697_P050) antibody
- Additional Information:
- IHC Information: Placenta
- Target Reference:
- Souren,N.Y., (er) Int J Obes (Lond) (2008) In press
- Publications:
Müller, L; Kowalewski, MP; Reichler, IM; Kollár, E; Balogh, O; Different expression of leptin and IGF1 in the adult and prepubertal testis in dogs. 52 Suppl 2, 187-192 (2017). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28101891
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
