Search Antibody, Protein, and ELISA Kit Solutions

LEP Antibody - N-terminal region (ARP41697_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41697_P050-FITC Conjugated

ARP41697_P050-HRP Conjugated

ARP41697_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: Placenta
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LEP
Official Gene Full Name:
leptin
NCBI Gene Id:
3952
Protein Name:
leptin
Swissprot Id:
P41159
Protein Accession #:
NP_000221
Nucleotide Accession #:
NM_000230
Alias Symbols:
OB, OBS, LEPD
Replacement Item:
This antibody may replace item sc-28344 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
Protein Size (# AA):
167
Molecular Weight:
19kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LEP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LEP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LEP
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 91%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 91%
Complete computational species homology data:
Anti-LEP (ARP41697_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3;
Blocking Peptide:
For anti-LEP (ARP41697_P050) antibody is Catalog # AAP41697 (Previous Catalog # AAPP24340)
Datasheets/Manuals:
Printable datasheet for anti-LEP (ARP41697_P050) antibody
Target Reference:
Souren,N.Y., (er) Int J Obes (Lond) (2008) In press
Publications:

Müller, L; Kowalewski, MP; Reichler, IM; Kollár, E; Balogh, O; Different expression of leptin and IGF1 in the adult and prepubertal testis in dogs. 52 Suppl 2, 187-192 (2017). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28101891

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...