Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP41697_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41697_P050-FITC Conjugated

ARP41697_P050-HRP Conjugated

ARP41697_P050-Biotin Conjugated

LEP Antibody - N-terminal region (ARP41697_P050)

Catalog#: ARP41697_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Placenta
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-28344 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LEP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 91%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 91%
Complete computational species homology data Anti-LEP (ARP41697_P050)
Peptide Sequence Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LEP (ARP41697_P050) antibody is Catalog # AAP41697 (Previous Catalog # AAPP24340)
Datasheets/Manuals Printable datasheet for anti-LEP (ARP41697_P050) antibody
Target Reference Souren,N.Y., (er) Int J Obes (Lond) (2008) In press
Publications

Müller, L; Kowalewski, MP; Reichler, IM; Kollár, E; Balogh, O; Different expression of leptin and IGF1 in the adult and prepubertal testis in dogs. 52 Suppl 2, 187-192 (2017). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28101891

Gene Symbol LEP
Official Gene Full Name leptin
Alias Symbols OB, OBS, LEPD
NCBI Gene Id 3952
Protein Name leptin
Description of Target This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
Swissprot Id P41159
Protein Accession # NP_000221
Nucleotide Accession # NM_000230
Protein Size (# AA) 167
Molecular Weight 19kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LEP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LEP.
Protein Interactions Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3;
  1. What is the species homology for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "LEP Antibody - N-terminal region (ARP41697_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LEP Antibody - N-terminal region (ARP41697_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    This target may also be called "OB, OBS, LEPD" in publications.

  5. What is the shipping cost for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LEP Antibody - N-terminal region (ARP41697_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LEP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LEP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LEP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LEP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LEP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LEP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LEP Antibody - N-terminal region (ARP41697_P050)
Your Rating
We found other products you might like!