LEMD2 Antibody - middle region (ARP55792_P050)

Catalog No: ARP55792_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-LEMD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LEMD2 (ARP55792_P050) antibody is Catalog # AAP55792 (Previous Catalog # AAPP36815)

Target Info

• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126
• Gene Symbol: LEMD2
• Gene Full Name: LEM domain containing 2
• Alias Symbols: LEM2, NET25, CTRCT42, dJ482C21.1
• NCBI Gene Id: 221496
• Protein Name: LEM domain-containing protein 2
• Description of Target: LEMD2 is involved in nuclear structure organization.
• Uniprot ID: Q8NC56
• Protein Accession #: NP_851853
• Nucleotide Accession #: NM_181336
• Protein Size (# AA): 503
• Molecular Weight: 57 kDa
• Protein Interactions: K3; SH3KBP1; UBC;