Catalog No: P100889_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LEF1 (P100889_P050) antibody
Product Info
ReferencePetropoulos,K., (2008) J. Exp. Med. 205 (3), 515-522
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LEF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
Concentration0.5 mg/ml
Blocking PeptideFor anti-LEF1 (P100889_P050) antibody is Catalog # AAP31236 (Previous Catalog # AAPP01981)
Gene SymbolLEF1
Gene Full NameLymphoid enhancer-binding factor 1
Alias SymbolsLEF-1, TCF10, TCF7L3, TCF1ALPHA
NCBI Gene Id51176
Protein NameLymphoid enhancer-binding factor 1
Description of TargetLymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1). Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9UJU2
Protein Accession #NP_057353
Nucleotide Accession #NM_016269
Protein Size (# AA)399
Molecular Weight44kDa
  1. What is the species homology for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "LEF1 Antibody - N-terminal region (P100889_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LEF1 Antibody - N-terminal region (P100889_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    This target may also be called "LEF-1, TCF10, TCF7L3, TCF1ALPHA" in publications.

  5. What is the shipping cost for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LEF1 Antibody - N-terminal region (P100889_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LEF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LEF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LEF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LEF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LEF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LEF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LEF1 Antibody - N-terminal region (P100889_P050)
Your Rating
We found other products you might like!