LECT1 Recombinant Protein (Human) (OPCA04172)

Catalog No: OPCA04172

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
• Protein Sequence: EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 215-334 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Expression of cartilage-specific functional matrix chondromodulin-I mRNA in rabbit growth plate chondrocytes and its responsiveness to growth stimuli in vitro.Shukunami C., Hiraki Y.Biochem. Biophys. Res. Commun. 249:885-890(1998)

Target Info

• Gene Symbol: CNMD
• Gene Full Name: chondromodulin
• Alias Symbols: BRICD3;BRICHOS domain containing 3;CHM1;CHM-I;Chondromodulin;chondromodulin-1;chondromodulin-I;LECT1;leukocyte cell derived chemotaxin 1;leukocyte cell-derived chemotaxin 1;multiple myeloma tumor suppressor 1;MYETS1.
• NCBI Gene Id: 11061
• Protein Name: Leukocyte cell-derived chemotaxin 1
• Description of Target: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.
• Uniprot ID: O75829
• Protein Accession #: NP_001011705
• Nucleotide Accession #: NM_001011705
• Protein Size (# AA): Recombinant
• Molecular Weight: 29.8 kDa