SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55308_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LDLRAP1 Antibody - N-terminal region (ARP55308_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-LDLRAP1 (ARP55308_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LDLRAP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK
Concentration0.5 mg/ml
Blocking PeptideFor anti-LDLRAP1 (ARP55308_P050) antibody is Catalog # AAP55308 (Previous Catalog # AAPP33139)
ReferenceMameza,M.G., (2007) J. Neurochem. 103 (3), 927-941
Gene SymbolLDLRAP1
Gene Full NameLow density lipoprotein receptor adaptor protein 1
Alias SymbolsARH, ARH1, ARH2, FHCB1, FHCB2, FHCL4
NCBI Gene Id26119
Protein NameLow density lipoprotein receptor adapter protein 1
Description of TargetLDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. LDLRAP1 may also be involved in the internalization of other LDLR family members. LDLRAP1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ5SW96
Protein Accession #NP_056442
Nucleotide Accession #NM_015627
Protein Size (# AA)308
Molecular Weight34kDa
Protein InteractionsOBFC1; AP2B1; UBC; KLC1; LDLR; LRP2; CLTC; TFAP2A; APP;
  1. What is the species homology for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    This target may also be called "ARH, ARH1, ARH2, FHCB1, FHCB2, FHCL4" in publications.

  5. What is the shipping cost for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LDLRAP1 Antibody - N-terminal region (ARP55308_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LDLRAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LDLRAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LDLRAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LDLRAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LDLRAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LDLRAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LDLRAP1 Antibody - N-terminal region (ARP55308_P050)
Your Rating
We found other products you might like!