Catalog No: ARP53602_P050
Price: $0.00
SKU
ARP53602_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LDHC Antibody - middle region (ARP53602_P050)

Datasheets/ManualsPrintable datasheet for anti-LDHC (ARP53602_P050) antibody
Product Info
ReferenceSharma,P.R., (2007) Clin. Biochem. 40 (18), 1414-1419
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LDHC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Goat: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
Concentration0.5 mg/ml
Blocking PeptideFor anti-LDHC (ARP53602_P050) antibody is Catalog # AAP53602 (Previous Catalog # AAPS33106)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Gene SymbolLDHC
Gene Full Namelactate dehydrogenase C
Alias SymbolsCT32, LDH3, LDHX
NCBI Gene Id3948
Protein NameL-lactate dehydrogenase C chain
Description of TargetLactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Uniprot IDP07864
Protein Accession #NP_002292
Nucleotide Accession #NM_002301
Protein Size (# AA)332
Molecular Weight36 kDa
Protein InteractionsMAPK7; SUMO2; RBL2; LIG4; BRCA1;
  1. What is the species homology for "LDHC Antibody - middle region (ARP53602_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "LDHC Antibody - middle region (ARP53602_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LDHC Antibody - middle region (ARP53602_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LDHC Antibody - middle region (ARP53602_P050)"?

    This target may also be called "CT32, LDH3, LDHX" in publications.

  5. What is the shipping cost for "LDHC Antibody - middle region (ARP53602_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LDHC Antibody - middle region (ARP53602_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LDHC Antibody - middle region (ARP53602_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LDHC Antibody - middle region (ARP53602_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LDHC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LDHC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LDHC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LDHC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LDHC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LDHC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LDHC Antibody - middle region (ARP53602_P050)
Your Rating
We found other products you might like!