- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-LDHA (OAAN00238) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
:: | Positive Control: MCF-7, 293T, NIH/3T3, K562, Jurkat, mouse skeletal muscle Cellular Location: Cytoplasm |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-332 of human LDHA (NP_005557.1). |
Purification | Affinity purified against immunogen |
Peptide Sequence | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Application Info | WB: 1:500~2000 IF: 1:50~200 IP: 1:50~100 |
Gene Symbol | LDHA |
---|---|
Gene Full Name | lactate dehydrogenase A |
Alias Symbols | LDHM, GSD11, PIG19, HEL-S-133P |
NCBI Gene Id | 3939 |
Protein Name | L-lactate dehydrogenase A chain |
Description of Target | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. |
Uniprot ID | P00338 |
Protein Accession # | NP_001128711.1 |
Nucleotide Accession # | NM_001135239.1 |
Molecular Weight | 37 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "LDHA Antibody (OAAN00238)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "LDHA Antibody (OAAN00238)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "LDHA Antibody (OAAN00238)" provided in?
This item is provided in "Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "LDHA Antibody (OAAN00238)"?
This target may also be called "LDHM, GSD11, PIG19, HEL-S-133P" in publications.
-
What is the shipping cost for "LDHA Antibody (OAAN00238)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "LDHA Antibody (OAAN00238)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "LDHA Antibody (OAAN00238)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "37 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "LDHA Antibody (OAAN00238)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "LDHA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "LDHA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "LDHA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "LDHA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "LDHA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "LDHA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.