Search Antibody, Protein, and ELISA Kit Solutions

LDHA Antibody - N-terminal region : Biotin (ARP54776_P050-Biotin)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54776_P050 Unconjugated

ARP54776_P050-FITC Conjugated

ARP54776_P050-HRP Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
lactate dehydrogenase A
Protein Name:
L-lactate dehydrogenase A chain
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LDHM, GSD11, PIG19, HEL-S-133P
Replacement Item:
This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-LDHA (ARP54776_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LDHA (ARP54776_P050-Biotin) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Printable datasheet for anti-LDHA (ARP54776_P050-Biotin) antibody
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Target Reference:
Listerman,I., PLoS Genet. 3 (11), E212 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...