Catalog No: ARP54776_P050
Price: $0.00
SKU
ARP54776_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LDHA (ARP54776_P050) antibody
Product Info
ReferenceListerman,I., PLoS Genet. 3 (11), E212 (2007)
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Concentration0.5 mg/ml
Blocking PeptideFor anti-LDHA (ARP54776_P050) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Enhanced Validation
WBY
SPRY
YCHAROS
Gene SymbolLDHA
Gene Full Namelactate dehydrogenase A
Alias SymbolsLDHM, GSD11, PIG19, HEL-S-133P
NCBI Gene Id3939
Protein NameL-lactate dehydrogenase A chain
Description of TargetThe protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Uniprot IDP00338
Protein Accession #NP_005557
Nucleotide Accession #NM_005566
Protein Size (# AA)332
Molecular Weight37 kDa
Protein InteractionsMAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
  1. What is the species homology for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LDHA Antibody - N-terminal region (ARP54776_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    This target may also be called "LDHM, GSD11, PIG19, HEL-S-133P" in publications.

  5. What is the shipping cost for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LDHA Antibody - N-terminal region (ARP54776_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LDHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LDHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LDHA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LDHA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LDHA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LDHA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LDHA Antibody - N-terminal region (ARP54776_P050)
Your Rating
We found other products you might like!