Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54777_P050 Unconjugated

ARP54777_P050-FITC Conjugated

ARP54777_P050-Biotin Conjugated

LDHA Antibody - middle region : HRP (ARP54777_P050-HRP)

Catalog#: ARP54777_P050-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LDHA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Zebrafish: 92%
Complete computational species homology data Anti-LDHA (ARP54777_P050)
Peptide Sequence Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Concentration 0.5 mg/ml
Blocking Peptide For anti-LDHA (ARP54777_P050-HRP) antibody is Catalog # AAP54777 (Previous Catalog # AAPP31572)
Datasheets/Manuals Printable datasheet for anti-LDHA (ARP54777_P050-HRP) antibody
Sample Type Confirmation

LDHA is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Listerman,I., PLoS Genet. 3 (11), E212 (2007)
Gene Symbol LDHA
Official Gene Full Name lactate dehydrogenase A
Alias Symbols LDHM, GSD11, PIG19, HEL-S-133P
NCBI Gene Id 3939
Protein Name L-lactate dehydrogenase A chain
Description of Target The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Swissprot Id P00338
Protein Accession # NP_005557
Nucleotide Accession # NM_005566
Protein Size (# AA) 332
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Write Your Own Review
You're reviewing:LDHA Antibody - middle region : HRP (ARP54777_P050-HRP)
Your Rating