Size:100 ul
$319.00
In stock
SKU
ARP54777_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54777_P050-FITC Conjugated

ARP54777_P050-HRP Conjugated

ARP54777_P050-Biotin Conjugated

LDHA Antibody - middle region (ARP54777_P050)

Catalog#: ARP54777_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-130327 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LDHA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Zebrafish: 92%
Complete computational species homology dataAnti-LDHA (ARP54777_P050)
Peptide SequenceSynthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LDHA (ARP54777_P050) antibody is Catalog # AAP54777 (Previous Catalog # AAPP31572)
Datasheets/ManualsPrintable datasheet for anti-LDHA (ARP54777_P050) antibody
Sample Type Confirmation

LDHA is supported by BioGPS gene expression data to be expressed in HeLa

Target ReferenceListerman,I., PLoS Genet. 3 (11), E212 (2007)
Gene SymbolLDHA
Official Gene Full Namelactate dehydrogenase A
Alias SymbolsLDHM, GSD11, PIG19, HEL-S-133P
NCBI Gene Id3939
Protein NameL-lactate dehydrogenase A chain
Description of TargetThe protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Swissprot IdP00338
Protein Accession #NP_005557
Nucleotide Accession #NM_005566
Protein Size (# AA)332
Molecular Weight37kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LDHA.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LDHA.
Protein InteractionsMAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
Write Your Own Review
You're reviewing:LDHA Antibody - middle region (ARP54777_P050)
Your Rating
Aviva Validation Data
Aviva Blast Tool
Aviva Live Chat
Aviva Travel Grant