Size:100 ul
$319.00
In Stock
SKU
ARP54777_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54777_P050-FITC Conjugated

ARP54777_P050-HRP Conjugated

ARP54777_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LDHA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Zebrafish: 92%
Complete computational species homology data Anti-LDHA (ARP54777_P050)
Peptide Sequence Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LDHA (ARP54777_P050) antibody is Catalog # AAP54777 (Previous Catalog # AAPP31572)
Datasheets/Manuals Printable datasheet for anti-LDHA (ARP54777_P050) antibody
Sample Type Confirmation

LDHA is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Listerman,I., PLoS Genet. 3 (11), E212 (2007)
Gene Symbol LDHA
Official Gene Full Name lactate dehydrogenase A
Alias Symbols LDHM, GSD11, PIG19, HEL-S-133P
NCBI Gene Id 3939
Protein Name L-lactate dehydrogenase A chain
Description of Target The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Swissprot Id P00338
Protein Accession # NP_005557
Nucleotide Accession # NM_005566
Protein Size (# AA) 332
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Protein Interactions MAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
  1. What is the species homology for "LDHA Antibody - middle region (ARP54777_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "LDHA Antibody - middle region (ARP54777_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LDHA Antibody - middle region (ARP54777_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LDHA Antibody - middle region (ARP54777_P050)"?

    This target may also be called "LDHM, GSD11, PIG19, HEL-S-133P" in publications.

  5. What is the shipping cost for "LDHA Antibody - middle region (ARP54777_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LDHA Antibody - middle region (ARP54777_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LDHA Antibody - middle region (ARP54777_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LDHA Antibody - middle region (ARP54777_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LDHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LDHA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LDHA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LDHA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LDHA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LDHA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LDHA Antibody - middle region (ARP54777_P050)
Your Rating
We found other products you might like!