Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LDB1 Antibody - C-terminal region : FITC (ARP74027_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74027_P050 Unconjugated

ARP74027_P050-HRP Conjugated

ARP74027_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LDB1
NCBI Gene Id:
8861
Swissprot Id:
Q86U70
Alias Symbols:
LDB1, CLIM2,
Description of Target:
LDB1 binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. It may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. It acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state.
Protein Size (# AA):
411
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDB1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
LHX8; LHX6; SSBP3; LMO4; LMX1B; LMO2; LMO1; POLR1B; LSM7; IRAK3; UBC; PSMD10; PSMA1; TRIM33; ATXN1; RNF38; RNF6; rlim-a; RLIM; RB1; TAL1; LHX2; LMO3; SSBP4; SSBP2; TOLLIP; CTDSP1; LHX3; SSBP1; ISL1; LMX1A; ESR1; TCF3; SP1; CBFA2T3;
Blocking Peptide:
For anti-LDB1 (ARP74027_P050-FITC) antibody is Catalog # AAP74027
Datasheets/Manuals:
Printable datasheet for anti-LDB1 (ARP74027_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...