Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LDAH Antibody - C-terminal region (ARP62773_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP62773_P050-FITC Conjugated

ARP62773_P050-HRP Conjugated

ARP62773_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LDAH
NCBI Gene Id:
60526
Official Gene Full Name:
lipid droplet associated hydrolase
Protein Name:
lipid droplet-associated hydrolase
Swissprot Id:
Q9H6V9
Protein Accession #:
NP_068744
Nucleotide Accession #:
NM_021925
Alias Symbols:
hLDAH, C2orf43
Protein Size (# AA):
325
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDAH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDAH.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 100%; Rat: 89%
Complete computational species homology data:
Anti-C2orf43 (ARP62773_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-LDAH (ARP62773_P050) antibody is Catalog # AAP62773
Datasheets/Manuals:
Printable datasheet for anti-LDAH (ARP62773_P050) antibody
Sample Type Confirmation:

C2orf43 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Tell us what you think about this item!

Write A Review
    Please, wait...