Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LDAH Antibody - C-terminal region (ARP62773_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62773_P050-FITC Conjugated

ARP62773_P050-HRP Conjugated

ARP62773_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
lipid droplet associated hydrolase
NCBI Gene Id:
Protein Name:
lipid droplet-associated hydrolase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
hLDAH, C2orf43
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDAH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDAH.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 100%; Rat: 89%
Complete computational species homology data:
Anti-C2orf43 (ARP62773_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LDAH (ARP62773_P050) antibody is Catalog # AAP62773
Printable datasheet for anti-LDAH (ARP62773_P050) antibody
Sample Type Confirmation:

C2orf43 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...