LCP1 Antibody - N-terminal region (ARP54686_P050)

Catalog No: ARP54686_P050

WB Suggested Anti-LCP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LCP1 (ARP54686_P050) antibody is Catalog # AAP54686 (Previous Catalog # AAPP31477)
• Reference: Klemke,M., (2007) Int. J. Cancer 120 (12), 2590-2599

Target Info

• Gene Symbol: LCP1
• Gene Full Name: Lymphocyte cytosolic protein 1 (L-plastin)
• Alias Symbols: LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN
• NCBI Gene Id: 3936
• Protein Name: Plastin-2
• Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P13796
• Protein Accession #: NP_002289
• Nucleotide Accession #: NM_002298
• Protein Size (# AA): 627
• Molecular Weight: 70kDa
• Protein Interactions: UBC; Aif1; FN1; RAD23B; SIRT7; GCA; CNN3; PRKACA; ATXN2; LCP1;