SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP76347_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP76347_P050-FITC
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-LCP1 (ARP76347_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARK
Concentration0.5 mg/ml
Blocking PeptideFor Anti-LCP1 antibody is Catalog # AAP76347
ReferenceN/A
Gene SymbolLCP1
Gene Full Namelymphocyte cytosolic protein 1 (L-plastin)
Alias SymbolsLPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN
NCBI Gene Id3936
Description of TargetPlastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
Uniprot IDP13796
Protein Accession #XP_005266431.1
Protein Size (# AA)627
Molecular Weight68 kDa
  1. What is the species homology for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    This target may also be called "LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN" in publications.

  5. What is the shipping cost for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LCP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LCP1 Antibody - C-terminal region : FITC (ARP76347_P050-FITC)
Your Rating
We found other products you might like!