Search Antibody, Protein, and ELISA Kit Solutions

LCP1 Antibody - C-terminal region (ARP76347_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76347_P050-FITC Conjugated

ARP76347_P050-HRP Conjugated

ARP76347_P050-Biotin Conjugated

Gene Symbol:
LCP1
Official Gene Full Name:
lymphocyte cytosolic protein 1 (L-plastin)
NCBI Gene Id:
3936
Swissprot Id:
P13796
Protein Accession #:
XP_005266431.1
Alias Symbols:
LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN
Replacement Item:
This antibody may replace item sc-159508 from Santa Cruz Biotechnology.
Description of Target:
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
Protein Size (# AA):
627
Molecular Weight:
68 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LCP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LCP1.
Immunogen:
The immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Blocking Peptide:
For Anti-LCP1 antibody is Catalog # AAP76347
Datasheets/Manuals:
Printable datasheet for anti-LCP1 (ARP76347_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...