Catalog No: ARP54685_P050
Price: $0.00
SKU
ARP54685_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LCN1 Antibody - middle region (ARP54685_P050)

Datasheets/ManualsPrintable datasheet for anti-LCN1 (ARP54685_P050) antibody
Product Info
ReferenceYusifov,T.N., (er) Mol. Vis. 14, 180-188 (2008)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LCN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 79%; Pig: 79%; Rat: 82%
Peptide SequenceSynthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
Concentration0.5 mg/ml
Blocking PeptideFor anti-LCN1 (ARP54685_P050) antibody is Catalog # AAP54685 (Previous Catalog # AAPP36804)
Gene SymbolLCN1
Gene Full NameLipocalin 1
Alias SymbolsTP, TLC, PMFA, VEGP
NCBI Gene Id3933
Protein NameLipocalin-1
Description of TargetLCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP31025
Protein Accession #NP_002288
Nucleotide Accession #NM_002297
Protein Size (# AA)176
Molecular Weight17kDa
Protein InteractionsWWOX; UBC; Cdca5; LMBR1L; LYZ; LTF; KHK;
  1. What is the species homology for "LCN1 Antibody - middle region (ARP54685_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Pig".

  2. How long will it take to receive "LCN1 Antibody - middle region (ARP54685_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LCN1 Antibody - middle region (ARP54685_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LCN1 Antibody - middle region (ARP54685_P050)"?

    This target may also be called "TP, TLC, PMFA, VEGP" in publications.

  5. What is the shipping cost for "LCN1 Antibody - middle region (ARP54685_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LCN1 Antibody - middle region (ARP54685_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LCN1 Antibody - middle region (ARP54685_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LCN1 Antibody - middle region (ARP54685_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LCN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LCN1 Antibody - middle region (ARP54685_P050)
Your Rating
We found other products you might like!