Size:100 ul
$229.00
In stock
SKU
ARP41695_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41695_T100-FITC Conjugated

ARP41695_T100-HRP Conjugated

ARP41695_T100-Biotin Conjugated

LCAT Antibody - N-terminal region (ARP41695_T100)

Catalog#: ARP41695_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-376682 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LCAT
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-LCAT (ARP41695_T100)
Peptide Sequence Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LCAT (ARP41695_T100) antibody is Catalog # AAP41695 (Previous Catalog # AAPP24338)
Datasheets/Manuals Printable datasheet for anti-LCAT (ARP41695_T100) antibody
Sample Type Confirmation

LCAT is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Calabresi,L., (2005) Arterioscler. Thromb. Vasc. Biol. 25 (9), 1972-1978
Publications

Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23166663

Gene Symbol LCAT
Official Gene Full Name Lecithin-cholesterol acyltransferase
NCBI Gene Id 3931
Protein Name Phosphatidylcholine-sterol acyltransferase
Description of Target LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
Swissprot Id P04180
Protein Accession # NP_000220
Nucleotide Accession # NM_000229
Protein Size (# AA) 440
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LCAT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LCAT.
Protein Interactions APOA1; EXOSC10; APOE; APOA2; A2M;
Write Your Own Review
You're reviewing:LCAT Antibody - N-terminal region (ARP41695_T100)
Your Rating