Search Antibody, Protein, and ELISA Kit Solutions

LCAT Antibody - C-terminal region (ARP41696_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41696_P050-FITC Conjugated

ARP41696_P050-HRP Conjugated

ARP41696_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Lecithin-cholesterol acyltransferase
NCBI Gene Id:
Protein Name:
Phosphatidylcholine-sterol acyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-376682 from Santa Cruz Biotechnology.
Description of Target:
LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LCAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LCAT.
The immunogen is a synthetic peptide directed towards the C terminal region of human LCAT
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-LCAT (ARP41696_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LCAT (ARP41696_P050) antibody is Catalog # AAP41696 (Previous Catalog # AAPP24339)
Printable datasheet for anti-LCAT (ARP41696_P050) antibody
Target Reference:
Aranda,P., (2008) Clin. Nephrol. 69 (3), 213-218

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...