Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LCAT antibody - C-terminal region (ARP41696_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP41696_P050-FITC Conjugated

ARP41696_P050-HRP Conjugated

ARP41696_P050-Biotin Conjugated

Gene Symbol:
LCAT
NCBI Gene Id:
3931
Official Gene Full Name:
Lecithin-cholesterol acyltransferase
Protein Name:
Phosphatidylcholine-sterol acyltransferase
Swissprot Id:
P04180
Protein Accession #:
NP_000220
Nucleotide Accession #:
NM_000229
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-376682 from Santa Cruz Biotechnology.
Description of Target:
LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
440
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LCAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LCAT.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human LCAT
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-LCAT (ARP41696_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
APOA1; EXOSC10; APOE; APOA2; A2M;
Blocking Peptide:
For anti-LCAT (ARP41696_P050) antibody is Catalog # AAP41696 (Previous Catalog # AAPP24339)
Datasheets/Manuals:
Printable datasheet for anti-LCAT (ARP41696_P050) antibody
Target Reference:
Aranda,P., (2008) Clin. Nephrol. 69 (3), 213-218

Tell us what you think about this item!

Write A Review
    Please, wait...