LCA5 Antibody - N-terminal region (ARP53410_P050)

Catalog No: ARP53410_P050

WB Suggested Anti-LCA5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCA5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LCA5 (ARP53410_P050) antibody is Catalog # AAP53410 (Previous Catalog # AAPP30992)
• Reference: Ramprasad,V.L., (er) Mol. Vis. 14, 481-486 (2008)

Target Info

• Gene Symbol: LCA5
• Gene Full Name: Leber congenital amaurosis 5
• Alias Symbols: C6orf152
• NCBI Gene Id: 167691
• Protein Name: Lebercilin
• Description of Target: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. This gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.
• Uniprot ID: Q86VQ0
• Protein Accession #: NP_859065
• Nucleotide Accession #: NM_181714
• Protein Size (# AA): 697
• Molecular Weight: 80kDa
• Protein Interactions: TXLNA; RCOR3; SRPK2;