Search Antibody, Protein, and ELISA Kit Solutions

LBP antibody - C-terminal region (ARP41546_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41546_P050-FITC Conjugated

ARP41546_P050-HRP Conjugated

ARP41546_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Lipopolysaccharide binding protein
Protein Name:
Lipopolysaccharide-binding protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC22233, BPIFD2
Replacement Item:
This antibody may replace item sc-14666, HPA001508
Description of Target:
LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP).The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found on chromosome 20, immediately downstream of the BPI gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LBP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LBP.
The immunogen is a synthetic peptide directed towards the C terminal region of human LBP
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Horse: 85%; Human: 100%; Pig: 79%
Complete computational species homology data:
Anti-LBP (ARP41546_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LBP (ARP41546_P050) antibody is Catalog # AAP41546 (Previous Catalog # AAPP24232)
Printable datasheet for anti-LBP (ARP41546_P050) antibody
Target Reference:
Knapp,S., (2006) J. Immunol. 176 (5), 3189-3195

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...