- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
LBP Antibody - C-terminal region (ARP41546_P050)
Datasheets/Manuals | Printable datasheet for anti-LBP (ARP41546_P050) antibody |
---|
Tested Species Reactivity | Human | ||
---|---|---|---|
Predicted Species Reactivity | Human, Cow, Horse, Pig | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | WB, IHC | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LBP | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Horse: 85%; Human: 100%; Pig: 79% | ||
Peptide Sequence | Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-LBP (ARP41546_P050) antibody is Catalog # AAP41546 (Previous Catalog # AAPP24232) | ||
Enhanced Validation |
| ||
Reference | Knapp,S., (2006) J. Immunol. 176 (5), 3189-3195 | ||
Publications | Seasonal heat load is more potent than the degree of body weight loss in dysregulating immune function by reducing white blood cell populations and increasing inflammation in Holstein dairy cows. J Dairy Sci. 103, 10809-10822 (2020). 32896401 | ||
Description |
Gene Symbol | LBP |
---|---|
Gene Full Name | Lipopolysaccharide binding protein |
Alias Symbols | BPIFD2 |
NCBI Gene Id | 3929 |
Protein Name | Lipopolysaccharide-binding protein |
Description of Target | LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP).The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found on chromosome 20, immediately downstream of the BPI gene. |
Uniprot ID | P18428 |
Protein Accession # | NP_004130 |
Nucleotide Accession # | NM_004139 |
Protein Size (# AA) | 481 |
Molecular Weight | 53 kDa |
Protein Interactions | TSC22D4; PYCRL; TRA2A; PRDX4; SETD1A; CBFA2T2; BAG6; PSMA3; SMAD3; HSPB1; FTH1; C4BPA; BST1; CAMP; APOA1; RPS21; CD14; CFHR1; IRF6; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "LBP Antibody - C-terminal region (ARP41546_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Horse, Pig".
-
How long will it take to receive "LBP Antibody - C-terminal region (ARP41546_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "LBP Antibody - C-terminal region (ARP41546_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "LBP Antibody - C-terminal region (ARP41546_P050)"?
This target may also be called "BPIFD2" in publications.
-
What is the shipping cost for "LBP Antibody - C-terminal region (ARP41546_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "LBP Antibody - C-terminal region (ARP41546_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "LBP Antibody - C-terminal region (ARP41546_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "53 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "LBP Antibody - C-terminal region (ARP41546_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "LBP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "LBP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "LBP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "LBP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "LBP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "LBP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.