Size:100 ul
$319.00
In stock
SKU
ARP40847_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40847_P050-FITC Conjugated

ARP40847_P050-HRP Conjugated

ARP40847_P050-Biotin Conjugated

LARP7 Antibody - C-terminal region (ARP40847_P050)

Catalog#: ARP40847_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-243235 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-LARP7 (ARP40847_P050)
Peptide Sequence Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LARP7 (ARP40847_P050) antibody is Catalog # AAP40847 (Previous Catalog # AAPY01099)
Datasheets/Manuals Printable datasheet for anti-LARP7 (ARP40847_P050) antibody
Target Reference Krueger,B.J., (2008) Nucleic Acids Res. 36 (7), 2219-2229
Publications

Egloff, S; Vitali, P; Tellier, M; Raffel, R; Murphy, S; Kiss, T; The 7SK snRNP associates with the little elongation complex to promote snRNA gene expression. 36, 934-948 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28254838

Muniz, L., Egloff, S. & Kiss, T. RNA elements directing in vivo assembly of the 7SK/MePCE/Larp7 transcriptional regulatory snRNP. Nucleic Acids Res. 41, 4686-98 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23471002

Gene Symbol LARP7
Official Gene Full Name La ribonucleoprotein domain family, member 7
Alias Symbols DKFZP564K112, HDCMA18P, MGC104360, PIP7S
NCBI Gene Id 51574
Protein Name La-related protein 7
Description of Target The function remains unknown.
Swissprot Id Q4G0J3
Protein Accession # NP_056269
Nucleotide Accession # NM_015454
Protein Size (# AA) 582
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LARP7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LARP7.
Protein Interactions HEXIM1; AFF1; CDK9; CCNT1; UBC; LIN28B; LIN28A; MEPCE; RNF2; VCPIP1; RABEP2; BRCC3; RPP25; CD2AP; JMJD6; HNRNPR; TRIM28; HUWE1; MTA2; SPAG9; TSC22D1; HDAC1; NR3C1; RN7SK; RPS16; HNRNPA1; CSNK2A1; tat; PAXIP1; BARD1; APP; CAND1; SIRT7; PRPF40A; Ybx1; Nhp2l
Write Your Own Review
You're reviewing:LARP7 Antibody - C-terminal region (ARP40847_P050)
Your Rating