Search Antibody, Protein, and ELISA Kit Solutions

LARP7 Antibody - C-terminal region (ARP40847_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40847_P050-FITC Conjugated

ARP40847_P050-HRP Conjugated

ARP40847_P050-Biotin Conjugated

Gene Symbol:
LARP7
Official Gene Full Name:
La ribonucleoprotein domain family, member 7
NCBI Gene Id:
51574
Protein Name:
La-related protein 7
Swissprot Id:
Q4G0J3
Protein Accession #:
NP_056269
Nucleotide Accession #:
NM_015454
Alias Symbols:
DKFZP564K112, HDCMA18P, MGC104360, PIP7S
Replacement Item:
This antibody may replace item sc-243235 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
582
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LARP7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LARP7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-LARP7 (ARP40847_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HEXIM1; AFF1; CDK9; CCNT1; UBC; LIN28B; LIN28A; MEPCE; RNF2; VCPIP1; RABEP2; BRCC3; RPP25; CD2AP; JMJD6; HNRNPR; TRIM28; HUWE1; MTA2; SPAG9; TSC22D1; HDAC1; NR3C1; RN7SK; RPS16; HNRNPA1; CSNK2A1; tat; PAXIP1; BARD1; APP; CAND1; SIRT7; PRPF40A; Ybx1; Nhp2l
Blocking Peptide:
For anti-LARP7 (ARP40847_P050) antibody is Catalog # AAP40847 (Previous Catalog # AAPY01099)
Datasheets/Manuals:
Printable datasheet for anti-LARP7 (ARP40847_P050) antibody
Target Reference:
Krueger,B.J., (2008) Nucleic Acids Res. 36 (7), 2219-2229
Publications:

Egloff, S; Vitali, P; Tellier, M; Raffel, R; Murphy, S; Kiss, T; The 7SK snRNP associates with the little elongation complex to promote snRNA gene expression. 36, 934-948 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28254838

Muniz, L., Egloff, S. & Kiss, T. RNA elements directing in vivo assembly of the 7SK/MePCE/Larp7 transcriptional regulatory snRNP. Nucleic Acids Res. 41, 4686-98 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23471002

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...