Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LAPTM4B antibody - middle region (ARP47442_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP47442_P050-FITC Conjugated

ARP47442_P050-HRP Conjugated

ARP47442_P050-Biotin Conjugated

Gene Symbol:
LAPTM4B
NCBI Gene Id:
55353
Official Gene Full Name:
Lysosomal protein transmembrane 4 beta
Protein Name:
Lysosomal-associated transmembrane protein 4B
Swissprot Id:
Q86VI4-3
Protein Accession #:
NP_060877
Nucleotide Accession #:
NM_018407
Alias Symbols:
LAPTM4beta, LC27
Replacement Item:
This antibody may replace item sc-87802 from Santa Cruz Biotechnology.
Description of Target:
LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
Protein Size (# AA):
317
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LAPTM4B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LAPTM4B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4B
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-LAPTM4B (ARP47442_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NAALADL2; TFRC; NEDD4; UBC;
Blocking Peptide:
For anti-LAPTM4B (ARP47442_P050) antibody is Catalog # AAP47442 (Previous Catalog # AAPP28320)
Datasheets/Manuals:
Printable datasheet for anti-LAPTM4B (ARP47442_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that LAPTM4B is expressed in HEK293T

Target Reference:
Cheng,X.J., (2008) Ann. Oncol. 19 (3), 527-532

Tell us what you think about this item!

Write A Review
    Please, wait...