- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-LAMC1 (ARP58233_P050-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LAMC1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-LAMC1 (ARP58233_P050-HRP) antibody is Catalog # AAP58233 (Previous Catalog # AAPP32832) |
Subunit | gamma-1 |
Reference | Jakobsson,L., (2008) FASEB J. 22 (5), 1530-1539 |
Gene Symbol | LAMC1 |
---|---|
Gene Full Name | Laminin, gamma 1 (formerly LAMB2) |
Alias Symbols | LAMB2 |
NCBI Gene Id | 3915 |
Protein Name | Laminin subunit gamma-1 |
Description of Target | Laminin is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Gamma-1 is a subunit of laminin-1 (EHS laminin), laminin-2 (merosin), laminin-3 (S-laminin), laminin-4 (S-merosin), laminin-6 (K-laminin) and laminin-7 (KS-laminin). Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P11047 |
Protein Accession # | NP_002284 |
Nucleotide Accession # | NM_002293 |
Protein Size (# AA) | 1609 |
Molecular Weight | 177kDa |
Protein Interactions | UBC; TUBG1; LGR4; ANTXR2; HECW2; SRPK1; TANK; SNX2; PDIA3; APP; FBXO6; ELAVL1; Lama1; LAMB1; CENPU; EIF3I; CCDC53; ATF7IP; SNAPIN; NID2; LAMA5; NID1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
This target may also be called "LAMB2" in publications.
-
What is the shipping cost for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "177kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "LAMC1 Antibody - middle region : HRP (ARP58233_P050-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "LAMC1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "LAMC1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "LAMC1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "LAMC1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "LAMC1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "LAMC1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.