Search Antibody, Protein, and ELISA Kit Solutions

KYAT1 Antibody - N-terminal region : FITC (ARP75980_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75980_P050 Unconjugated

ARP75980_P050-HRP Conjugated

ARP75980_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
KYAT1
Official Gene Full Name:
kynurenine aminotransferase 1
NCBI Gene Id:
883
Protein Name:
kynurenine--oxoglutarate transaminase 1
Swissprot Id:
Q16773
Protein Accession #:
NP_004050
Alias Symbols:
GTK, KAT1, KATI, CCBL1
Description of Target:
This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.
Protein Size (# AA):
422
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KYAT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KYAT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KAT1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-KYAT1 (ARP75980_P050-FITC) antibody is Catalog # AAP75980
Datasheets/Manuals:
Printable datasheet for anti-KYAT1 (ARP75980_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...