Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42028_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42028_P050-FITC Conjugated

ARP42028_P050-HRP Conjugated

ARP42028_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101459 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 92%
Complete computational species homology data Anti-KRT8 (ARP42028_P050)
Peptide Sequence Synthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KRT8 (ARP42028_P050) antibody is Catalog # AAP42028 (Previous Catalog # AAPP24509)
Datasheets/Manuals Printable datasheet for anti-KRT8 (ARP42028_P050) antibody
Target Reference Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Gene Symbol KRT8
Official Gene Full Name Keratin 8
Alias Symbols CARD2, CK8, CYK8, K2C8, K8, KO, CK-8
NCBI Gene Id 3856
Protein Name Keratin, type II cytoskeletal 8
Description of Target KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Swissprot Id P05787
Protein Accession # NP_002264
Nucleotide Accession # NM_002273
Protein Size (# AA) 483
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KRT8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KRT8.
Protein Interactions KRT31; KRT15; KRT13; KRT40; TFIP11; KRT38; UBC; MDM2; ASB12; EED; GRB2; FBXO25; PAN2; IQCB1; IKBKG; VCAM1; NOS2; KRT18; KPNA2; ITGA4; FN1; ATF2; CDH1; STAM2; CRK; UBASH3B; APEX1; RCHY1; SQSTM1; SUMO1; SUMO2; SUMO3; MAPK8; QRSL1; YWHAQ; TJP1; TADA2A; USP32
  1. What is the species homology for "KRT8 Antibody (ARP42028_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast".

  2. How long will it take to receive "KRT8 Antibody (ARP42028_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KRT8 Antibody (ARP42028_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KRT8 Antibody (ARP42028_P050)"?

    This target may also be called "CARD2, CK8, CYK8, K2C8, K8, KO, CK-8" in publications.

  5. What is the shipping cost for "KRT8 Antibody (ARP42028_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KRT8 Antibody (ARP42028_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KRT8 Antibody (ARP42028_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KRT8 Antibody (ARP42028_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KRT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KRT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KRT8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KRT8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KRT8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KRT8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KRT8 Antibody (ARP42028_P050)
Your Rating
We found other products you might like!