Search Antibody, Protein, and ELISA Kit Solutions

KRT8 Antibody (ARP42028_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42028_P050-FITC Conjugated

ARP42028_P050-HRP Conjugated

ARP42028_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Keratin 8
Protein Name:
Keratin, type II cytoskeletal 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CARD2, CK8, CYK8, K2C8, K8, KO, CK-8
Replacement Item:
This antibody may replace item sc-101459 from Santa Cruz Biotechnology.
Description of Target:
KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KRT8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KRT8.
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 92%
Complete computational species homology data:
Anti-KRT8 (ARP42028_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KRT8 (ARP42028_P050) antibody is Catalog # AAP42028 (Previous Catalog # AAPP24509)
Printable datasheet for anti-KRT8 (ARP42028_P050) antibody
Target Reference:
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...