Search Antibody, Protein, and ELISA Kit Solutions

KRT79 Antibody - C-terminal region (ARP73475_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73475_P050-FITC Conjugated

ARP73475_P050-HRP Conjugated

ARP73475_P050-Biotin Conjugated

Gene Symbol:
KRT79
NCBI Gene Id:
338785
Swissprot Id:
Q5XKE5
Protein Accession #:
NP_787028
Alias Symbols:
KRT79, K6L, KB38, KRT6L,
Replacement Item:
This antibody may replace item sc-146427 from Santa Cruz Biotechnology.
Description of Target:
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in skeletal muscle, skin and scalp. The type II keratins are clustered in a region of chromosome 12q13.
Protein Size (# AA):
535
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KRT79.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KRT79.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT79
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELTRTI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRT31; KRT15; KRT13; USHBP1; KRT38; KRT33B; LGR4; BAG3; UBC; SIRT1; UBASH3B; CRK; AP2M1; CBL; PIK3R2; INPPL1; EPS15; BTRC;
Blocking Peptide:
For anti-KRT79 (ARP73475_P050) antibody is Catalog # AAP73475
Datasheets/Manuals:
Printable datasheet for anti-KRT79 (ARP73475_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...