Catalog No: ARP64419_P050
Price: $0.00
SKU
ARP64419_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KRT6A (ARP64419_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Peptide SequenceSynthetic peptide located within the following region: RGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKAD
Concentration0.5 mg/ml
Blocking PeptideFor anti-KRT6A (ARP64419_P050) antibody is Catalog # AAP64419
Gene SymbolKRT6A
Gene Full NameKeratin 6A
Alias SymbolsK6A, K6C, K6D, PC3, CK6A, CK6C, CK6D, CK-6C, CK-6E, KRT6C, KRT6D
NCBI Gene Id3853
Protein NameKeratin, type II cytoskeletal 6A
Description of TargetThe protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Uniprot IDP02538
Protein Accession #NP_005545
Nucleotide Accession #NM_005554
Protein Size (# AA)564
Molecular Weight59kDa
Protein InteractionsTRIM54; KRT40; TFIP11; HGS; KRT38; SGTA; KRT31; KRT15; KRT13; KIFC3; GOLGA2; TRIM23; LGR4; EED; KDM1A; PAN2; Iqcb1; Nphp4; Cep290; Nphp1; Invs; UBC; ITGA4; ALB; UBASH3B; SHC1; GRB2; EPS15; CRK; AP2M1; CBL; CUL1; COPS5; CUL2; CUL5; CCDC85B; TCHP; CCDC53; K
  1. What is the species homology for "KRT6A Antibody - middle region (ARP64419_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "KRT6A Antibody - middle region (ARP64419_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KRT6A Antibody - middle region (ARP64419_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KRT6A Antibody - middle region (ARP64419_P050)"?

    This target may also be called "K6A, K6C, K6D, PC3, CK6A, CK6C, CK6D, CK-6C, CK-6E, KRT6C, KRT6D" in publications.

  5. What is the shipping cost for "KRT6A Antibody - middle region (ARP64419_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KRT6A Antibody - middle region (ARP64419_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KRT6A Antibody - middle region (ARP64419_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KRT6A Antibody - middle region (ARP64419_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KRT6A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KRT6A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KRT6A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KRT6A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KRT6A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KRT6A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KRT6A Antibody - middle region (ARP64419_P050)
Your Rating
We found other products you might like!