Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP76339_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP76339_P050-FITC
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-KRT16 (ARP76339_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen for Anti-KRT16 antibody is: synthetic peptide directed towards the C-terminal region of Human K1C16
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: QEYQILLDVKTRLEQEIATYRRLLEGEDAHLSSQQASGQSYSSREVFTSS
Concentration0.5 mg/ml
Blocking PeptideFor Anti-KRT16 antibody is Catalog # AAP76339
ReferenceN/A
Gene SymbolKRT16
Gene Full Namekeratin 16, type I
Alias SymbolsK16, PC1, CK16, K1CP, NEPPK, FNEPPK, KRT16A
NCBI Gene Id3868
Description of TargetThe protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.
Uniprot IDP08779
Protein Accession #NP_005548.2
Protein Size (# AA)473
Molecular Weight52 kDa
  1. What is the species homology for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    This target may also be called "K16, PC1, CK16, K1CP, NEPPK, FNEPPK, KRT16A" in publications.

  5. What is the shipping cost for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KRT16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KRT16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KRT16"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KRT16"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KRT16"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KRT16"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KRT16 Antibody - C-terminal region : FITC (ARP76339_P050-FITC)
Your Rating
We found other products you might like!