Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
AVARP00005_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP00005_P050-FITC Conjugated

AVARP00005_P050-HRP Conjugated

AVARP00005_P050-Biotin Conjugated

KRT15 Antibody - C-terminal region (AVARP00005_P050)

Catalog#: AVARP00005_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Human, Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-44524, HPA024554
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Human: 100%; Mouse: 86%
Complete computational species homology data Anti-KRT15 (AVARP00005_P050)
Peptide Sequence Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KRT15 (AVARP00005_P050) antibody is Catalog # AAP30450 (Previous Catalog # AAPP34741)
Datasheets/Manuals Printable datasheet for anti-KRT15 (AVARP00005_P050) antibody
Target Reference Radoja,N., et al., (2004) Mol. Cell. Biol. 24 (8), 3168-3179
Publications

Celis, J. E. et al. 15-prostaglandin dehydrogenase expression alone or in combination with ACSM1 defines a subgroup of the apocrine molecular subtype of breast carcinoma. Mol. Cell. Proteomics 7, 1795-809 (2008). IHC, WB, Cow, Human, Mouse 18632593

Gene Symbol KRT15
Official Gene Full Name Keratin 15
Alias Symbols CK15, K15, K1CO
NCBI Gene Id 3866
Protein Name Keratin, type I cytoskeletal 15
Description of Target The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P19012
Protein Accession # NP_002266
Nucleotide Accession # NM_002275
Protein Size (# AA) 456
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KRT15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KRT15.
Protein Interactions MBD3; NUP54; AMOTL2; SPG21; WAC; CYTH4; PRPF31; ARFIP2; ZFYVE26; OIP5; HMG20B; ABI2; CEP57; CREB5; HGS; USP2; LMO4; TMSB4X; SMARCE1; RAD51D; PSMB1; PSMA1; PKN1; PIK3R2; NEFL; MOS; LMO2; KRT86; KRT8; KRT6B; KRT6A; KRT5; KRT4; KIFC3; GFAP; TIMM8A; COX5B; CC
  1. What is the species homology for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Human, Mouse".

  2. How long will it take to receive "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KRT15 Antibody - C-terminal region (AVARP00005_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    This target may also be called "CK15, K15, K1CO" in publications.

  5. What is the shipping cost for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KRT15 Antibody - C-terminal region (AVARP00005_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KRT15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KRT15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KRT15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KRT15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KRT15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KRT15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KRT15 Antibody - C-terminal region (AVARP00005_P050)
Your Rating
We found other products you might like!