Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

KRT15 Antibody - C-terminal region (AVARP00005_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP00005_P050-FITC Conjugated

AVARP00005_P050-HRP Conjugated

AVARP00005_P050-Biotin Conjugated

Gene Symbol:
KRT15
Official Gene Full Name:
Keratin 15
NCBI Gene Id:
3866
Protein Name:
Keratin, type I cytoskeletal 15
Swissprot Id:
P19012
Protein Accession #:
NP_002266
Nucleotide Accession #:
NM_002275
Alias Symbols:
CK15, K15, K1CO
Replacement Item:
This antibody may replace item sc-44524, HPA024554
Description of Target:
The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
456
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KRT15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KRT15.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15
Predicted Species Reactivity:
Cow, Human, Mouse
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Human: 100%; Mouse: 86%
Complete computational species homology data:
Anti-KRT15 (AVARP00005_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MBD3; NUP54; AMOTL2; SPG21; WAC; CYTH4; PRPF31; ARFIP2; ZFYVE26; OIP5; HMG20B; ABI2; CEP57; CREB5; HGS; USP2; LMO4; TMSB4X; SMARCE1; RAD51D; PSMB1; PSMA1; PKN1; PIK3R2; NEFL; MOS; LMO2; KRT86; KRT8; KRT6B; KRT6A; KRT5; KRT4; KIFC3; GFAP; TIMM8A; COX5B; CC
Blocking Peptide:
For anti-KRT15 (AVARP00005_P050) antibody is Catalog # AAP30450 (Previous Catalog # AAPP34741)
Datasheets/Manuals:
Printable datasheet for anti-KRT15 (AVARP00005_P050) antibody
Target Reference:
Radoja,N., et al., (2004) Mol. Cell. Biol. 24 (8), 3168-3179
Publications:

Celis, J. E. et al. 15-prostaglandin dehydrogenase expression alone or in combination with ACSM1 defines a subgroup of the apocrine molecular subtype of breast carcinoma. Mol. Cell. Proteomics 7, 1795-809 (2008). IHC, WB, Cow, Human, Mouse 18632593

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...