Kras Antibody - N-terminal region (ARP55409_P050)

Catalog No: ARP55409_P050

WB Suggested Anti-Kras Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Lung

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Kras (ARP55409_P050) antibody is Catalog # AAP55409

Target Info

• Gene Symbol: Kras
• Gene Full Name: V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
• Alias Symbols: p21, Kras2, c-Ki-ras
• NCBI Gene Id: 24525
• Protein Name: V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog EMBL AAI26087.1
• Description of Target: Kras is a oncogene and member of the small GTPase superfamily.
• Uniprot ID: A0JN17
• Protein Accession #: NP_113703
• Nucleotide Accession #: NM_031515
• Protein Size (# AA): 188
• Molecular Weight: 20kDa
• Protein Interactions: Cdk2; Cdk4; Ccnd2; Ccne1; Cdc27; Cdc20; Skp2; Ubc;