KPNA5 Antibody - C-terminal region : FITC (ARP54679_P050-FITC)

Catalog No: ARP54679_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KPNA5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 86%; Rat: 86%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KPNA5 (ARP54679_P050-FITC) antibody is Catalog # AAP54679 (Previous Catalog # AAPP31470)
• Subunit: alpha-6

Target Info

• Reference: Singh,A.P., (2007) Cell 131 (3), 492-504
• Gene Symbol: KPNA5
• Gene Full Name: Karyopherin alpha 5 (importin alpha 6)
• Alias Symbols: SRP6, IPOA6
• NCBI Gene Id: 3841
• Protein Name: Importin subunit alpha-6
• Description of Target: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O15131
• Protein Accession #: NP_002260
• Nucleotide Accession #: NM_002269
• Protein Size (# AA): 539
• Molecular Weight: 61kDa
• Protein Interactions: SPOPL; NUP50; ANP32B; IL32; UBC; KPNB1; ANP32A; BRMS1; CUL3; MEPCE; CDKN1B;