Catalog No: ARP54674_P050
Price: $0.00
SKU
ARP54674_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KPNA3 Antibody - N-terminal region (ARP54674_P050)

Datasheets/ManualsPrintable datasheet for anti-KPNA3 (ARP54674_P050) antibody
Product Info
ReferenceSingh,A.P., (2007) Cell 131 (3), 492-504
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 77%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
Concentration0.5 mg/ml
Blocking PeptideFor anti-KPNA3 (ARP54674_P050) antibody is Catalog # AAP54674 (Previous Catalog # AAPP31465)
Sample Type Confirmation

KPNA3 is strongly supported by BioGPS gene expression data to be expressed in HepG2, MCF7

KPNA3 is supported by BioGPS gene expression data to be expressed in HeLa

Subunitalpha-3
Gene SymbolKPNA3
Gene Full NameKaryopherin alpha 3 (importin alpha 4)
Alias SymbolsSRP1, SRP4, IPOA4, hSRP1, SRP1gamma
NCBI Gene Id3839
Protein NameImportin subunit alpha-3
Description of TargetThe transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO00505
Protein Accession #NP_002258
Nucleotide Accession #NM_002267
Protein Size (# AA)521
Molecular Weight58kDa
Protein InteractionsTEX37; SLC5A11; APOL6; RPRD1A; ZCCHC10; MAT2B; NUP50; TSSC4; ZBTB24; DDX21; MTA1; HNRNPC; FTL; MVP; HSF1; UBC; MMS19; KPNA6; MCM6; MCM4; HDAC1; UL122; NACC1; NFE2L2; MYOD1; GTF2H1; GATA6; ERCC3; EPHA2; CBX5; TP53BP1; BARD1; ZNF131; COIL; CUL3; Ranbp2; Mki
  1. What is the species homology for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish".

  2. How long will it take to receive "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KPNA3 Antibody - N-terminal region (ARP54674_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    This target may also be called "SRP1, SRP4, IPOA4, hSRP1, SRP1gamma" in publications.

  5. What is the shipping cost for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KPNA3 Antibody - N-terminal region (ARP54674_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KPNA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KPNA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KPNA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KPNA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KPNA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KPNA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KPNA3 Antibody - N-terminal region (ARP54674_P050)
Your Rating
We found other products you might like!