Search Antibody, Protein, and ELISA Kit Solutions

KPNA2 Antibody - C-terminal region (ARP97714_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KPNA2
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: KIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KPNA2 (ARP97714_P050) antibody is Catalog # AAP97714
Datasheets/Manuals:
Printable datasheet for anti-KPNA2 (ARP97714_P050) antibody
Gene Symbol:
KPNA2
Official Gene Full Name:
karyopherin subunit alpha 2
Alias Symbols:
QIP2, RCH1, IPOA1, SRP1alpha, SRP1-alpha
NCBI Gene Id:
3838
Protein Name:
importin subunit alpha-1
Description of Target:
The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. Alternative splicing results in multiple transcript variants.
Swissprot Id:
P52292
Protein Accession #:
NP_001307540.1
Nucleotide Accession #:
NM_001320611.1
Protein Size (# AA):
529
Molecular Weight:
58 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KPNA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KPNA2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...