Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP45680_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45680_P050-FITC Conjugated

ARP45680_P050-HRP Conjugated

ARP45680_P050-Biotin Conjugated

KNG1 Antibody - middle region (ARP45680_P050)

Catalog#: ARP45680_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Mouse, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-14941 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KNG1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 85%; Human: 100%; Mouse: 77%; Pig: 92%
Complete computational species homology data Anti-KNG1 (ARP45680_P050)
Peptide Sequence Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KNG1 (ARP45680_P050) antibody is Catalog # AAP45680 (Previous Catalog # AAPP11813)
Datasheets/Manuals Printable datasheet for anti-KNG1 (ARP45680_P050) antibody
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Horse, Human, Mouse, Pig 24465277

Gene Symbol KNG1
Official Gene Full Name Kininogen 1
Alias Symbols BDK, KNG
NCBI Gene Id 3827
Protein Name Kininogen-1
Description of Target Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Swissprot Id P01042
Protein Accession # NP_001095886
Nucleotide Accession # NM_001102416
Protein Size (# AA) 644
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KNG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KNG1.
Protein Interactions Ance; ECE1; COPS6; RXFP4; CPN1; F11; HABP2; CTSK; PREP; MEP1A; ITGB2; GP1BA; KLKB1; KNG1; VTN; THBS1; F2; PLAUR; PLG; KLK1; KRT1; FTL; ELANE; CD93; CTSL; CTSS; CTSG; CAPN2; CAPN1; AGT; APP;
Write Your Own Review
You're reviewing:KNG1 Antibody - middle region (ARP45680_P050)
Your Rating