Search Antibody, Protein, and ELISA Kit Solutions

KNG1 Antibody - middle region (ARP45680_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45680_P050-FITC Conjugated

ARP45680_P050-HRP Conjugated

ARP45680_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Horse, Human, Mouse, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
KNG1
Official Gene Full Name:
Kininogen 1
NCBI Gene Id:
3827
Protein Name:
Kininogen-1
Swissprot Id:
P01042
Protein Accession #:
NP_001095886
Nucleotide Accession #:
NM_001102416
Alias Symbols:
BDK, KNG
Replacement Item:
This antibody may replace item sc-14941 from Santa Cruz Biotechnology.
Description of Target:
Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Protein Size (# AA):
644
Molecular Weight:
72kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KNG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KNG1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KNG1
Predicted Homology Based on Immunogen Sequence:
Horse: 85%; Human: 100%; Mouse: 77%; Pig: 92%
Complete computational species homology data:
Anti-KNG1 (ARP45680_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Ance; ECE1; COPS6; RXFP4; CPN1; F11; HABP2; CTSK; PREP; MEP1A; ITGB2; GP1BA; KLKB1; KNG1; VTN; THBS1; F2; PLAUR; PLG; KLK1; KRT1; FTL; ELANE; CD93; CTSL; CTSS; CTSG; CAPN2; CAPN1; AGT; APP;
Blocking Peptide:
For anti-KNG1 (ARP45680_P050) antibody is Catalog # AAP45680 (Previous Catalog # AAPP11813)
Datasheets/Manuals:
Printable datasheet for anti-KNG1 (ARP45680_P050) antibody
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Horse, Human, Mouse, Pig 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...