Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP45680_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45680_P050-FITC Conjugated

ARP45680_P050-HRP Conjugated

ARP45680_P050-Biotin Conjugated

KNG1 Antibody - middle region (ARP45680_P050)

Catalog#: ARP45680_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Mouse, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-14941 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KNG1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 85%; Human: 100%; Mouse: 77%; Pig: 92%
Complete computational species homology data Anti-KNG1 (ARP45680_P050)
Peptide Sequence Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KNG1 (ARP45680_P050) antibody is Catalog # AAP45680 (Previous Catalog # AAPP11813)
Datasheets/Manuals Printable datasheet for anti-KNG1 (ARP45680_P050) antibody
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Horse, Human, Mouse, Pig 24465277

Gene Symbol KNG1
Official Gene Full Name Kininogen 1
Alias Symbols BDK, KNG
NCBI Gene Id 3827
Protein Name Kininogen-1
Description of Target Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Swissprot Id P01042
Protein Accession # NP_001095886
Nucleotide Accession # NM_001102416
Protein Size (# AA) 644
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KNG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KNG1.
Protein Interactions Ance; ECE1; COPS6; RXFP4; CPN1; F11; HABP2; CTSK; PREP; MEP1A; ITGB2; GP1BA; KLKB1; KNG1; VTN; THBS1; F2; PLAUR; PLG; KLK1; KRT1; FTL; ELANE; CD93; CTSL; CTSS; CTSG; CAPN2; CAPN1; AGT; APP;
  1. What is the species homology for "KNG1 Antibody - middle region (ARP45680_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Horse, Human, Mouse, Pig".

  2. How long will it take to receive "KNG1 Antibody - middle region (ARP45680_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KNG1 Antibody - middle region (ARP45680_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KNG1 Antibody - middle region (ARP45680_P050)"?

    This target may also be called "BDK, KNG" in publications.

  5. What is the shipping cost for "KNG1 Antibody - middle region (ARP45680_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KNG1 Antibody - middle region (ARP45680_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KNG1 Antibody - middle region (ARP45680_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KNG1 Antibody - middle region (ARP45680_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KNG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KNG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KNG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KNG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KNG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KNG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KNG1 Antibody - middle region (ARP45680_P050)
Your Rating
We found other products you might like!