Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

KMT5B Antibody - middle region : FITC (ARP34567_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34567_P050 Unconjugated

ARP34567_P050-HRP Conjugated

ARP34567_P050-Biotin Conjugated

Gene Symbol:
KMT5B
Official Gene Full Name:
lysine methyltransferase 5B
NCBI Gene Id:
51111
Protein Name:
histone-lysine N-methyltransferase KMT5B
Swissprot Id:
Q4FZB7
Alias Symbols:
CGI85, MRD51, CGI-85, SUV420H1
Replacement Item:
This antibody may replace item sc-134048 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
885
Molecular Weight:
99kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KMT5B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KMT5B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93%
Complete computational species homology data:
Anti-SUV420H1 (ARP34567_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SMARCD1; HIST1H4A; YWHAQ;
Blocking Peptide:
For anti-KMT5B (ARP34567_P050-FITC) antibody is Catalog # AAP34567 (Previous Catalog # AAPP05749)
Datasheets/Manuals:
Printable datasheet for anti-KMT5B (ARP34567_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Twells,R.C., et al., (2001) Genomics 72 (3), 231-241
Publications:

Gatta, R. & Mantovani, R. NF-Y substitutes H2A-H2B on active cell-cycle promoters: recruitment of CoREST-KDM1 and fine-tuning of H3 methylations. Nucleic Acids Res. 36, 6592-607 (2008). WB, IHC, IP, ChIP, Human, Rat, Horse, Guinea pig, Mouse, Dog 18940868

Murata, T. et al. Epigenetic histone modification of Epstein-Barr virus BZLF1 promoter during latency and reactivation in Raji cells. J. Virol. 86, 4752-61 (2012). WB, IHC, IP, ChIP, Human, Rat, Horse, Guinea pig, Mouse, Dog 22357272

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...