Search Antibody, Protein, and ELISA Kit Solutions

KMT5B Antibody - middle region (ARP34567_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34567_P050-FITC Conjugated

ARP34567_P050-HRP Conjugated

ARP34567_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-134048 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93%
Complete computational species homology data:
Anti-SUV420H1 (ARP34567_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KMT5B (ARP34567_P050) antibody is Catalog # AAP34567 (Previous Catalog # AAPP05749)
Printable datasheet for anti-KMT5B (ARP34567_P050) antibody
Target Reference:
Twells,R.C., et al., (2001) Genomics 72 (3), 231-241

Gatta, R. & Mantovani, R. NF-Y substitutes H2A-H2B on active cell-cycle promoters: recruitment of CoREST-KDM1 and fine-tuning of H3 methylations. Nucleic Acids Res. 36, 6592-607 (2008). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rat 18940868

Murata, T. et al. Epigenetic histone modification of Epstein-Barr virus BZLF1 promoter during latency and reactivation in Raji cells. J. Virol. 86, 4752-61 (2012). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rat 22357272

Gene Symbol:
Official Gene Full Name:
lysine methyltransferase 5B
Alias Symbols:
CGI85, MRD51, CGI-85, SUV420H1
NCBI Gene Id:
Protein Name:
histone-lysine N-methyltransferase KMT5B
Description of Target:
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Swissprot Id:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KMT5B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KMT5B.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...