Size:100 ul
$319.00
In Stock
SKU
ARP34567_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34567_P050-FITC Conjugated

ARP34567_P050-HRP Conjugated

ARP34567_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134048 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93%
Complete computational species homology data Anti-SUV420H1 (ARP34567_P050)
Peptide Sequence Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KMT5B (ARP34567_P050) antibody is Catalog # AAP34567 (Previous Catalog # AAPP05749)
Datasheets/Manuals Printable datasheet for anti-KMT5B (ARP34567_P050) antibody
Target Reference Twells,R.C., et al., (2001) Genomics 72 (3), 231-241
Publications

Gatta, R. & Mantovani, R. NF-Y substitutes H2A-H2B on active cell-cycle promoters: recruitment of CoREST-KDM1 and fine-tuning of H3 methylations. Nucleic Acids Res. 36, 6592-607 (2008). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rat 18940868

Murata, T. et al. Epigenetic histone modification of Epstein-Barr virus BZLF1 promoter during latency and reactivation in Raji cells. J. Virol. 86, 4752-61 (2012). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rat 22357272

Gene Symbol KMT5B
Official Gene Full Name lysine methyltransferase 5B
Alias Symbols CGI85, MRD51, CGI-85, SUV420H1
NCBI Gene Id 51111
Protein Name histone-lysine N-methyltransferase KMT5B
Description of Target This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q4FZB7
Protein Size (# AA) 885
Molecular Weight 99kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KMT5B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KMT5B.
Protein Interactions SMARCD1; HIST1H4A; YWHAQ;
  1. What is the species homology for "KMT5B Antibody - middle region (ARP34567_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "KMT5B Antibody - middle region (ARP34567_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KMT5B Antibody - middle region (ARP34567_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KMT5B Antibody - middle region (ARP34567_P050)"?

    This target may also be called "CGI85, MRD51, CGI-85, SUV420H1" in publications.

  5. What is the shipping cost for "KMT5B Antibody - middle region (ARP34567_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KMT5B Antibody - middle region (ARP34567_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KMT5B Antibody - middle region (ARP34567_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "99kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KMT5B Antibody - middle region (ARP34567_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KMT5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KMT5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KMT5B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KMT5B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KMT5B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KMT5B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KMT5B Antibody - middle region (ARP34567_P050)
Your Rating
We found other products you might like!